Amyloid Beta Pyroglutamate 3-42 Pre-formed Fibrils Citation Available Product Size(s) 100 ug £626.00 SPR-492-100UG Add to order Added to order 2 x 100 ug £931.00 SPR-492-2X100UG Add to order Added to order 5 x 100 ug £1771.00 SPR-492-5X100UG Add to order Added to order Academic Pricing Please contact us for academic pricing. Contact Us About this Product SKU: SPR-492 Additional Names: pyro abeta, pyro amyloid beta, Abeta, Amyloid beta peptide, Beta amyloid peptide, amyloid beta precursor protein peptide, pyroglutamate amyloid beta, AB BetaPE3, APP Application: Cell-based/Functional Assay, Western Blot CE/IVD: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only. Extra Details: Our Amyloid Beta pyroglutamate 3-42 (pyro AB Beta) Pre-formed Fibrils are generated from Amyloid Beta Peptide 3-42 pre-treated with 1,1,1,3,3,3-Hexafluoro-2-propanol (HFIP) using a previously published method (1,2). Our pyro AB Beta3-42 fibrils present as primarily long strands when observed under TEM and AFM, and have a unique high molecular weight signal on a Western Blot with an anti-amyloid beta antibody. Amyloid beta peptide (AB Beta) is generated by protease cleavage of amyloid precursor protein (APP), which aggregates into oligomers, protofibrils, fibrils and ultimately plaques. The accumulation of AB Beta plaques in the brain is considered a hallmark of Alzheimer's disease (AD), and most of the drugs tested for AD in the past 20 years have targeted amyloid beta accumulation (3). Pyroglutamate AB Beta 3-42 is an N-terminally truncated peptide species that is modified by glutaminyl cyclase and has been reported to compromise 15-45% of total amyloid beta deposits in brains of AD patients (4,5). Pyroglutamate AB Beta 3-42 exhibits higher aggregation propensity and neurotoxicity compared with full-length AB Beta 1-42 (6,7) and is an active target in the next generation AD therapeutic development (8). Molecular Weight: 4.3 kDa Purity: >95% Sequence: pyroEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Shipping Conditions: Dry Ice Storage Conditions: -70[o]C Supplier: StressMarq Biosciences Type: Proteins, Peptides, Small Molecules & Other Biomolecules: Synthetic Manufacturer's Data Sheet: Epitope Tag: Untagged TEM of amyloid beta pyroglutamate 3-42 fibrils (catalog# SPR-492). Negative stain transmission electron microscopy images acquired at 80 Kv on carbon coated 400 mesh copper grids using phosphotungstic acid and uranyl acetate stain. Scale bar = 500, 200 and 100 nm (left to right). Method: Samples were prepared for examination in the transmission electron microscope using the 'direct application method' (Doane and Anderson 1987). AFM of amyloid beta pyroglutamate 3-42 fibrils (catalog# SPR-492). Atomic force microscopy analysis of 1.0 mg/mL samples diluted to 0.1 mg/mL in 2% DMSO + 10 mM HCl, mounted on freshly cleaved mica, washed, dried and analyzed with tapping mode. Representative images are 10 x 10 um x-y (left) and 5 x 5 um x-y (middle) and 2 x 2 um x-y (right), all with a z-range of 6 nm. Western blot of amyloid beta pyroglutamate 3-42 fibrils (catalog# SPR-492) using anti-amyloid beta 6E10 antibody. Amyloid beta pyroglutamate 3-42 at 160 pmol was run on 4-12% Bis-Tris SDS-PAGE, transferred to nitrocellulose in the presence of 0.02% v/v Tween-20, and blotted with 1:1000 mouse 6E10 primary antibody (Biolegend). Compared to monomers re-suspended in 2% DMSO and immediately run on SDS-PAGE, fibrils show monomer depletion, a signal from 37 kDa upwards and a distinct signal in the stacking gel. MW ladder = Precision Plus Dual Xtra prestained standards. Need Help? View product citations for proteins SPR-492 on CiteAb